PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG570600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 456aa    MW: 49276.2 Da    PI: 5.5491
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG570600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS307.23.8e-94614522373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalkl..fsev 87 
                          ++lL++cA+a++++d++l+q++L+ l+++a pdgd++qRl+a f+ AL ar +r   ++ + +a+++  +s   ++++++a++l  f+++
  Pavir.2NG570600.1.p  61 EQLLVHCANAIEANDATLTQQILWVLNNIAPPDGDSNQRLTAAFLCALVARASRtgACKAVTAAVAAAVESAALHVHRFTAVELasFVDL 150
                          79***************************************************943444555555444444444777777777789**** PP

                 GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.....skeeleetgerLakfAeel 172
                          +P+++f++ +aN aIleaveg   vH++ ++ ++++Q p+L++ LasR+egpp lR+T+ + ++++        ++ e+g +L +fA++ 
  Pavir.2NG570600.1.p 151 TPWHRFGYTAANAAILEAVEGFPVVHVVELGTTHCMQIPTLIDMLASRAEGPPILRLTVAHVAAPSapppaLDMSYDELGAKLINFARSR 240
                          ***********************************************************999888888987778899************* PP

                 GRAS 173 gvpfefnvl.......vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles......erdevLklvkslsPkvvvvveqeadhn 249
                          +++++f+v+        ++ +++l++++L ++  Eal+Vn+++ lh+++de++ + s       r+ +Lk +++l P++vvvve++ad +
  Pavir.2NG570600.1.p 241 NMSMDFRVVttspadaFTSLVDQLRVQQLVLDGTEALVVNCHMLLHTVPDETAGSVSlaqpvsLRTMLLKSLRTLDPNLVVVVEEDADFT 330
                          *********666655445556677888888888****************998777666657767999*********************** PP

                 GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                          +++ + r+  a+++ +  +d++++ l++ se+r+++E+e +g++++nv+a+eg +r+er+e  ++W +r+++aGF++v+++e+aa ++k+
  Pavir.2NG570600.1.p 331 AGDVVGRLRAAFNFLWIPYDAVDTFLSKGSEQRRWYEAE-IGWKVENVLAQEGVDRVERQEDRARWDQRMRSAGFRAVAFGEEAAGEVKA 419
                          ***************************************.************************************************** PP

                 GRAS 340 llrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          +l++++  g+ ++ e++ lvl+Wk++++v++SaW
  Pavir.2NG570600.1.p 420 MLNEHA-AGWGMKREDDDLVLTWKGHNVVFASAW 452
                          ******.889999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.82734434IPR005202Transcription factor GRAS
PfamPF035141.3E-9161452IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MMQFTHTAPP PPPLHPNGHG GLGLGLFLDV GAPRARPWPG SFPTPASKIS LGNLNSTSCM  60
EQLLVHCANA IEANDATLTQ QILWVLNNIA PPDGDSNQRL TAAFLCALVA RASRTGACKA  120
VTAAVAAAVE SAALHVHRFT AVELASFVDL TPWHRFGYTA ANAAILEAVE GFPVVHVVEL  180
GTTHCMQIPT LIDMLASRAE GPPILRLTVA HVAAPSAPPP ALDMSYDELG AKLINFARSR  240
NMSMDFRVVT TSPADAFTSL VDQLRVQQLV LDGTEALVVN CHMLLHTVPD ETAGSVSLAQ  300
PVSLRTMLLK SLRTLDPNLV VVVEEDADFT AGDVVGRLRA AFNFLWIPYD AVDTFLSKGS  360
EQRRWYEAEI GWKVENVLAQ EGVDRVERQE DRARWDQRMR SAGFRAVAFG EEAAGEVKAM  420
LNEHAAGWGM KREDDDLVLT WKGHNVVFAS AWAPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-19624526374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432380.0AC243238.1 Panicum virgatum clone PV_ABa020-K10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958182.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-165SCL32_ARATH; Scarecrow-like protein 32
TrEMBLK3ZT660.0K3ZT66_SETIT; Uncharacterized protein
STRINGSi029796m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-148GRAS family protein